PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf03761g00013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 275aa    MW: 30170.4 Da    PI: 9.0123
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf03761g00013.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.41.5e-3842102262
                    zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                               k++a++cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rk+++ s
  Niben101Scf03761g00013.1  42 KDQAVNCPRCNSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGTLRNVPVGGGSRKKRRCS 102
                               7899*****************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-253091IPR003851Zinc finger, Dof-type
PfamPF027011.6E-3243100IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.72346100IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104884IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MDTTQWTQDV GLVTSMAAEL GPANVTCSRP SSTLEKKVRP QKDQAVNCPR CNSTNTKFCY  60
YNNYSLTQPR YFCKTCRRYW TEGGTLRNVP VGGGSRKKRR CSSSLSLSSS SQKLPDSNPN  120
PSLSHQNPNY RINLGNSQDL NLGPSIIHDH NYFHGVPEFL EFPTMDRGNN GNNQPLSSTS  180
STTPISTMDL LRTGIASRGL TSFISTPTPD INTLYRSSFL SGIQENGAKI MFPFGFLNKQ  240
LSGTSAEAAD NYNESKGQEN SSAGYWNGML GGGSW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009616794.11e-171PREDICTED: dof zinc finger protein DOF2.5-like
RefseqXP_016470461.11e-171PREDICTED: dof zinc finger protein DOF2.5-like
TrEMBLM1BMN51e-125M1BMN5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000486121e-124(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.48e-41Dof family protein